aksarayfx.com rapport :   Visitez le site


Titre:aksaray escort | aksaray gerçek escort bayan | aksaray eskort

La description :aksaray escortlar arasında gerçek aksaray escort bayanlar ile tanışın. aksaray anal escort, aksaray genç escort, aksaray olgun escort telefonları doğru escort...

Classement Alexa Global: # 14,801,625

L'adresse IP principale: 104.31.82.12,Votre serveur Singapore,Singapore ISP:CloudFlare Inc.  TLD:com Code postal:sg

Ce rapport est mis à jour en 31-Oct-2017

Created Date:2017-05-27
Changed Date:2017-08-28

Données techniques du aksarayfx.com


Geo IP vous fournit comme la latitude, la longitude et l'ISP (Internet Service Provider) etc. informations. Notre service GeoIP a trouvé l'hôte aksarayfx.com.Actuellement, hébergé dans Singapore et son fournisseur de services est CloudFlare Inc. .

Latitude: 1.2896699905396
Longitude: 103.85006713867
Pays: Singapore (sg)
Ville: Singapore
Région: Singapore
ISP: CloudFlare Inc.

the related websites

domaine Titre
aksarayfx.com aksaray escort | aksaray gerçek escort bayan | aksaray eskort
kahramanmarasevdenevenakliyat.info kahranmaraş escort | maraş gerçek escort bayan
sanliurfaemlak.info Şanlıurfa escort | urfa gerçek escort bayan
kastamonu-escortbayanlar2.xyz vip escort | vip gerçek escort bayan | efsane |
karaman-escortbayanlar.xyz vip escort | vip gerçek escort bayan | efsane |
carsambanovada.com x escort | x gerçek escort bayan | x eskort
vannakliyatambari.info van escort van gerçek escort bayan
seducetheheaven.com van escort van gerçek escort bayan
bayburtkarate.com bayburt gerçek escort
yalovahotel.info yalova escort -yalova gerçek escort bayan
didimdekiralikyazlik.info didim escort | didim gerçek escort bayan
afyonisrehberi.net afyon escort | afyon gerçek escort bayan
bergamaescortbayan.xyz bergama escort | bergama gerçek escort bayan -
sivasgazetesi.info sivas escort - sivas gerçek escort bayan
malatyagazetesi.info malatya escort | malatya gerçek escort | malatya escort bayan -

Analyse PopURL pour aksarayfx.com


http://aksarayfx.com/ads/oral-escort-bayan-ece/
http://aksarayfx.com/ad-category/aksaray-yeni-escort-bayan/
http://aksarayfx.com/ads/escort-bayan-esmer-demet/
http://aksarayfx.com/ad-category/aksaray-genc-escort-bayan/
http://aksarayfx.com/ads/aksaray-rus-escort-bayan-vika/
http://aksarayfx.com/ads/escort-bayan-esmer-demet/
http://aksarayfx.com/ads/aksaray-yeni-citir-escort-genc-bayan-melis/
http://aksarayfx.com/ad-category/aksaray-lolita-escort-bayan/
http://aksarayfx.com/aksaray-escort-bayan/
http://aksarayfx.com/ad-category/aksarayevegelenescort/
http://aksarayfx.com/ad-category/aksaray-rus-escort-bayan/
http://aksarayfx.com/create-listing/
http://aksarayfx.com/ad-category/aksarayescort/
http://aksarayfx.com/ad-category/aksaray-escortlar/
http://aksarayfx.com/ad-category/escort-aksaray/

Informations Whois


Whois est un protocole qui permet d'accéder aux informations d'enregistrement.Vous pouvez atteindre quand le site Web a été enregistré, quand il va expirer, quelles sont les coordonnées du site avec les informations suivantes. En un mot, il comprend ces informations;

Domain Name: AKSARAYFX.COM
Registry Domain ID: 2128378539_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-08-28T15:42:15Z
Creation Date: 2017-05-27T18:00:22Z
Registry Expiry Date: 2018-05-27T18:00:22Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: ELINORE.NS.CLOUDFLARE.COM
Name Server: JEROME.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-10-31T11:13:02Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

  REGISTRAR GoDaddy.com, LLC

SERVERS

  SERVER com.whois-servers.net

  ARGS domain =aksarayfx.com

  PORT 43

  TYPE domain
RegrInfo
DOMAIN

  NAME aksarayfx.com

  CHANGED 2017-08-28

  CREATED 2017-05-27

STATUS
clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
clientRenewProhibited https://icann.org/epp#clientRenewProhibited
clientTransferProhibited https://icann.org/epp#clientTransferProhibited
clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited

NSERVER

  ELINORE.NS.CLOUDFLARE.COM 173.245.58.153

  JEROME.NS.CLOUDFLARE.COM 173.245.59.181

  REGISTERED yes

Go to top

Erreurs


La liste suivante vous montre les fautes d'orthographe possibles des internautes pour le site Web recherché.

  • www.uaksarayfx.com
  • www.7aksarayfx.com
  • www.haksarayfx.com
  • www.kaksarayfx.com
  • www.jaksarayfx.com
  • www.iaksarayfx.com
  • www.8aksarayfx.com
  • www.yaksarayfx.com
  • www.aksarayfxebc.com
  • www.aksarayfxebc.com
  • www.aksarayfx3bc.com
  • www.aksarayfxwbc.com
  • www.aksarayfxsbc.com
  • www.aksarayfx#bc.com
  • www.aksarayfxdbc.com
  • www.aksarayfxfbc.com
  • www.aksarayfx&bc.com
  • www.aksarayfxrbc.com
  • www.urlw4ebc.com
  • www.aksarayfx4bc.com
  • www.aksarayfxc.com
  • www.aksarayfxbc.com
  • www.aksarayfxvc.com
  • www.aksarayfxvbc.com
  • www.aksarayfxvc.com
  • www.aksarayfx c.com
  • www.aksarayfx bc.com
  • www.aksarayfx c.com
  • www.aksarayfxgc.com
  • www.aksarayfxgbc.com
  • www.aksarayfxgc.com
  • www.aksarayfxjc.com
  • www.aksarayfxjbc.com
  • www.aksarayfxjc.com
  • www.aksarayfxnc.com
  • www.aksarayfxnbc.com
  • www.aksarayfxnc.com
  • www.aksarayfxhc.com
  • www.aksarayfxhbc.com
  • www.aksarayfxhc.com
  • www.aksarayfx.com
  • www.aksarayfxc.com
  • www.aksarayfxx.com
  • www.aksarayfxxc.com
  • www.aksarayfxx.com
  • www.aksarayfxf.com
  • www.aksarayfxfc.com
  • www.aksarayfxf.com
  • www.aksarayfxv.com
  • www.aksarayfxvc.com
  • www.aksarayfxv.com
  • www.aksarayfxd.com
  • www.aksarayfxdc.com
  • www.aksarayfxd.com
  • www.aksarayfxcb.com
  • www.aksarayfxcom
  • www.aksarayfx..com
  • www.aksarayfx/com
  • www.aksarayfx/.com
  • www.aksarayfx./com
  • www.aksarayfxncom
  • www.aksarayfxn.com
  • www.aksarayfx.ncom
  • www.aksarayfx;com
  • www.aksarayfx;.com
  • www.aksarayfx.;com
  • www.aksarayfxlcom
  • www.aksarayfxl.com
  • www.aksarayfx.lcom
  • www.aksarayfx com
  • www.aksarayfx .com
  • www.aksarayfx. com
  • www.aksarayfx,com
  • www.aksarayfx,.com
  • www.aksarayfx.,com
  • www.aksarayfxmcom
  • www.aksarayfxm.com
  • www.aksarayfx.mcom
  • www.aksarayfx.ccom
  • www.aksarayfx.om
  • www.aksarayfx.ccom
  • www.aksarayfx.xom
  • www.aksarayfx.xcom
  • www.aksarayfx.cxom
  • www.aksarayfx.fom
  • www.aksarayfx.fcom
  • www.aksarayfx.cfom
  • www.aksarayfx.vom
  • www.aksarayfx.vcom
  • www.aksarayfx.cvom
  • www.aksarayfx.dom
  • www.aksarayfx.dcom
  • www.aksarayfx.cdom
  • www.aksarayfxc.om
  • www.aksarayfx.cm
  • www.aksarayfx.coom
  • www.aksarayfx.cpm
  • www.aksarayfx.cpom
  • www.aksarayfx.copm
  • www.aksarayfx.cim
  • www.aksarayfx.ciom
  • www.aksarayfx.coim
  • www.aksarayfx.ckm
  • www.aksarayfx.ckom
  • www.aksarayfx.cokm
  • www.aksarayfx.clm
  • www.aksarayfx.clom
  • www.aksarayfx.colm
  • www.aksarayfx.c0m
  • www.aksarayfx.c0om
  • www.aksarayfx.co0m
  • www.aksarayfx.c:m
  • www.aksarayfx.c:om
  • www.aksarayfx.co:m
  • www.aksarayfx.c9m
  • www.aksarayfx.c9om
  • www.aksarayfx.co9m
  • www.aksarayfx.ocm
  • www.aksarayfx.co
  • aksarayfx.comm
  • www.aksarayfx.con
  • www.aksarayfx.conm
  • aksarayfx.comn
  • www.aksarayfx.col
  • www.aksarayfx.colm
  • aksarayfx.coml
  • www.aksarayfx.co
  • www.aksarayfx.co m
  • aksarayfx.com
  • www.aksarayfx.cok
  • www.aksarayfx.cokm
  • aksarayfx.comk
  • www.aksarayfx.co,
  • www.aksarayfx.co,m
  • aksarayfx.com,
  • www.aksarayfx.coj
  • www.aksarayfx.cojm
  • aksarayfx.comj
  • www.aksarayfx.cmo
 Afficher toutes les erreurs  Cacher toutes les erreurs